Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50041246
Substrate/Competitorn/a
Meas. Tech.ChEBML_201915
Ki 0.250000±n/a nM
Citation Glennon, RAIsmaiel, AMAblordeppey, SEl-Ashmawy, MFisher, JB Thioxanthene-derived analogs as sigma(1) receptor ligands. Bioorg Med Chem Lett14:2217-20 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041246
NameBDBM50041246
Synonyms:CHEMBL19544 | Methyl-phenethyl-(5-phenyl-pentyl)-amine
TypeSmall organic molecule
Emp. Form.C20H27N
Mol. Mass.281.4351
SMILESCN(CCCCCc1ccccc1)CCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a