Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50145014
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200962
Ki 0.31±n/a nM
Citation Berardi, FFerorelli, SAbate, CColabufo, NAContino, MPerrone, RTortorella, V 4-(tetralin-1-yl)- and 4-(naphthalen-1-yl)alkyl derivatives of 1-cyclohexylpiperazine as sigma receptor ligands with agonist sigma2 activity. J Med Chem47:2308-17 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50145014
NameBDBM50145014
Synonyms:1-Cyclohexyl-4-(5-methoxy-1,2,3,4-tetrahydro-naphthalen-1-ylmethyl)-piperazine | CHEMBL75878
TypeSmall organic molecule
Emp. Form.C22H34N2O
Mol. Mass.342.5182
SMILESCOc1cccc2C(CN3CCN(CC3)C3CCCCC3)CCCc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a