Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibonectin-binding protein C
LigandBDBM50148582
Substrate/Competitorn/a
Meas. Tech.ChEBML_35860
IC50 25670±n/a nM
Citation Gobec, SPlantan, IMravljak, JWilson, RABesra, GSKikelj, D Phosphonate inhibitors of antigen 85C, a crucial enzyme involved in the biosynthesis of the Mycobacterium tuberculosis cell wall. Bioorg Med Chem Lett14:3559-62 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibonectin-binding protein C
Name:Fibonectin-binding protein C
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36770.32
Organism:Mycobacterium tuberculosis
Description:ChEMBL_431881
Residue:340
Sequence:
MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVP
SASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQS
SFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILA
AYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQ
IPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148582
NameBDBM50148582
Synonyms:2-(1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-ethylethyl nonylphosphonate | CHEMBL118823 | Nonyl-phosphonic acid 2-(1,3-dioxo-1,3-dihydro-isoindol-2-yl)-ethyl ester ethyl ester
TypeSmall organic molecule
Emp. Form.C21H32NO5P
Mol. Mass.409.4562
SMILESCCCCCCCCCP(=O)(OCC)OCCN1C(=O)c2ccccc2C1=O
Structure
n/a