Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor alpha (PPAR alpha)
LigandBDBM50173365
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321484
IC50>15000±n/a nM
Citation Dropinski, JFAkiyama, TEinstein, MHabulihaz, BDoebber, TBerger, JPMeinke, PTShi, GQ Synthesis and biological activities of novel aryl indole-2-carboxylic acid analogs as PPARgamma partial agonists. Bioorg Med Chem Lett15:5035-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Name:Peroxisome proliferator-activated receptor
Synonyms:Nuclear receptor subfamily 1 group C member 1 | PPAR alpha/gamma | PPAR-alpha | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor
Type:Enzyme
Mol. Mass.:52222.08
Organism:Homo sapiens (Human)
Description:Q07869
Residue:468
Sequence:
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173365
NameBDBM50173365
Synonyms:5-CHLORO-1-(4-CHLOROBENZYL)-3-(PHENYLTHIO)-1H-INDOLE-2-CARBOXYLIC ACID | 5-Chloro-1-(4-chloro-benzyl)-3-phenylsulfanyl-1H-indole-2-carboxylic acid | CHEMBL370152
TypeSmall organic molecule
Emp. Form.C22H15Cl2NO2S
Mol. Mass.428.331
SMILESOC(=O)c1c(Sc2ccccc2)c2cc(Cl)ccc2n1Cc1ccc(Cl)cc1
Structure
n/a