Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagenase
LigandBDBM50177311
Substrate/Competitorn/a
Meas. Tech.ChEMBL_334537
Ki>5025±n/a nM
Citation Cherney, RJKing, BWGilmore, JLLiu, RQCovington, MBDuan, JJDecicco, CP Conversion of potent MMP inhibitors into selective TACE inhibitors. Bioorg Med Chem Lett16:1028-31 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Collagenase
Name:Matrix metalloproteinase (1 and 13)
Synonyms:Collagenase 3 | MMP-13 | Matrix metalloproteinase-13 | Matrix metalloproteinase-13 (MMP-13) | Matrix metalloproteinase-13 (MMP13)
Type:Enzyme
Mol. Mass.:53808.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:471
Sequence:
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177311
NameBDBM50177311
Synonyms:2-{2-[4-(2-methyl-quinolin-4-ylmethoxy)-phenyl]-ethyl}-1,1-dioxo-isothiazolidine-3-carboxylic acid hydroxyamide | CHEMBL204549
TypeSmall organic molecule
Emp. Form.C23H25N3O5S
Mol. Mass.455.527
SMILESCc1cc(COc2ccc(CCN3C(CCS3(=O)=O)C(=O)NO)cc2)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a