Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-1 (MMP1)
LigandBDBM50177311
Substrate/Competitorn/a
Meas. Tech.ChEMBL_334534
Ki>4949±n/a nM
Citation Cherney, RJKing, BWGilmore, JLLiu, RQCovington, MBDuan, JJDecicco, CP Conversion of potent MMP inhibitors into selective TACE inhibitors. Bioorg Med Chem Lett16:1028-31 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-1 (MMP1)
Name:Matrix metalloproteinase (1 and 13)
Synonyms:Fibroblast collagenase | Interstitial collagenase | MMP1 | Matrix metalloproteinase-1 | Matrix metalloproteinase-1 (MMP-1)
Type:Enzyme
Mol. Mass.:54010.26
Organism:Homo sapiens (Human)
Description:
Residue:469
Sequence:
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN
YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY
TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR
FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY
PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177311
NameBDBM50177311
Synonyms:2-{2-[4-(2-methyl-quinolin-4-ylmethoxy)-phenyl]-ethyl}-1,1-dioxo-isothiazolidine-3-carboxylic acid hydroxyamide | CHEMBL204549
TypeSmall organic molecule
Emp. Form.C23H25N3O5S
Mol. Mass.455.527
SMILESCc1cc(COc2ccc(CCN3C(CCS3(=O)=O)C(=O)NO)cc2)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a