Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50177360
Substrate/Competitorn/a
Meas. Tech.ChEMBL_331691
Ki 356±n/a nM
Citation Geneste, HBackfisch, GBraje, WDelzer, JHaupt, AHutchins, CWKing, LLKling, ATeschendorf, HJUnger, LWernet, W Synthesis and SAR of highly potent and selective dopamine D(3)-receptor antagonists: 1H-pyrimidin-2-one derivatives. Bioorg Med Chem Lett16:490-4 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50177360
NameBDBM50177360
Synonyms:1-(4-(4-(2-tert-butyl-6-(trifluoromethyl)pyrimidin-4-yl)piperazin-1-yl)butyl)-3,5-dimethylpyrimidine-2,4(1H,3H)-dione | CHEMBL426473
TypeSmall organic molecule
Emp. Form.C23H33F3N6O2
Mol. Mass.482.5423
SMILESCc1cn(CCCCN2CCN(CC2)c2cc(nc(n2)C(C)(C)C)C(F)(F)F)c(=O)n(C)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a