Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM50410594
Substrate/Competitorn/a
Meas. Tech.ChEMBL_325792
Ki 1.6±n/a nM
Citation Palmer, JTBryant, CWang, DXDavis, DESetti, ELRydzewski, RMVenkatraman, STian, ZQBurrill, LCMendonca, RVSpringman, EMcCarter, JChung, TCheung, HJanc, JWMcGrath, MSomoza, JREnriquez, PYu, ZWStrickley, RMLiu, LVenuti, MCPercival, MDFalgueyret, JPPrasit, POballa, RRiendeau, DYoung, RNWesolowski, GRodan, SBJohnson, CKimmel, DBRodan, G Design and synthesis of tri-ring P3 benzamide-containing aminonitriles as potent, selective, orally effective inhibitors of cathepsin K. J Med Chem48:7520-34 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:n/a
Type:Enzyme
Mol. Mass.:36879.51
Organism:Oryctolagus cuniculus (rabbit)
Description:n/a
Residue:329
Sequence:
MWGLKVLLLPVVSFALHPEEILDTQWELWKKTYSKQYNSKVDEISRRLIWEKNLKHISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPPSRSHSNDTLYIPDWEGRTPDSID
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENYGCGGG
YMTNAFQYVQRNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYGIQKGNKHWIIKNSWGE
SWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50410594
NameBDBM50410594
Synonyms:CHEMBL200596
TypeSmall organic molecule
Emp. Form.C28H38N6O2S
Mol. Mass.522.705
SMILESCC(C)N(C)C1CCN(CC1)c1nc(cs1)-c1ccc(cc1)C(=O)NC1(CCCCC1)C(=O)NCC#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a