Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
LigandBDBM50180777
Substrate/Competitorn/a
Meas. Tech.ChEMBL_327201
Ki 0.700000±n/a nM
Citation Lang, MDe Pol, SBaldauf, CHofmann, HJReiser, OBeck-Sickinger, AG Identification of the key residue of calcitonin gene related peptide (CGRP) 27-37 to obtain antagonists with picomolar affinity at the CGRP receptor. J Med Chem49:616-24 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Name:Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1
Synonyms:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 327200
Components:This complex has 2 components.
Component 1
Name:Adrenomedullin receptor AM1; CALCRL/RAMP2
Synonyms:Calcitonin gene-related peptide (CGRP) receptor | Calcitonin gene-related peptide 1 (CGRP) | Calcitonin receptor-like receptor
Type:Enzyme
Mol. Mass.:52931.38
Organism:Homo sapiens (Human)
Description:Q16602
Residue:461
Sequence:
MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQA
EGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRT
WTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNL
FFSFVCNSVVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTL
IVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICA
ALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEGKI
AEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Calcitonin-gene-related peptide receptor, CALCRL/RAMP1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:16992.80
Organism:Homo sapiens (Human)
Description:EBI_100673
Residue:148
Sequence:
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWG
RTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILY
PFIVVPITVTLLVTALVVWQSKRTEGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50180777
NameBDBM50180777
Synonyms:CHEMBL427759 | FV((1R,2R,3R)-beta-aminocyclopropane carboxylic acid)TDVGPFAF
TypeSmall organic molecule
Emp. Form.C61H81N11O17
Mol. Mass.1240.3593
SMILESCOC(=O)[C@H]1[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc2ccccc2)C(C)C)[C@@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a