Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium-dependent serotonin transporter
LigandBDBM50183152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_355134
Ki 0.07±n/a nM
Citation Boot, JRBoulet, SLClark, BPCases-Thomas, MJDelhaye, LDiker, KFairhurst, JFindlay, JGallagher, PTGilmore, JHarris, JRMasters, JJMitchell, SNNaik, MSimmonds, RGSmith, SMRichards, SJTimms, GHWhatton, MAWolfe, CNWood, VA N-Alkyl-N-arylmethylpiperidin-4-amines: novel dual inhibitors of serotonin and norepinephrine reuptake. Bioorg Med Chem Lett16:2714-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium-dependent serotonin transporter
Name:Monoamine transporter
Synonyms:5-HT Transporter | 5HT transporter | 5HTT | SERT | SLC6A4 | Serotonin Transporter (SERT) | Serotonin transporter (5HTT) | Serotonin transporter protein (SERT) | Sodium-dependent serotonin transporter (SERT) | Solute carrier family 6 member 4
Type:Multi-pass membrane protein
Mol. Mass.:70322.51
Organism:Homo sapiens (Human)
Description:P31645
Residue:630
Sequence:
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183152
NameBDBM50183152
Synonyms:CHEMBL206580 | N-(4-(trifluoromethyl)benzyl)-N-isobutylpiperidin-4-amine fumaric acid salt
TypeSmall organic molecule
Emp. Form.C17H25F3N2
Mol. Mass.314.389
SMILESCC(C)CN(Cc1ccc(cc1)C(F)(F)F)C1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a