Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCollagenase
LigandBDBM50183734
Substrate/Competitorn/a
Meas. Tech.ChEMBL_354461
Ki>2128±n/a nM
Citation Gilmore, JLKing, BWHarris, CMaduskuie, TMercer, SELiu, RQCovington, MBQian, MRibadeneria, MDVaddi, KTrzaskos, JMNewton, RCDecicco, CPDuan, JJ Synthesis and structure-activity relationship of a novel, achiral series of TNF-alpha converting enzyme inhibitors. Bioorg Med Chem Lett16:2699-704 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Collagenase
Name:Matrix metalloproteinase 2/9
Synonyms:67 kDa matrix metalloproteinase-9 | 82 kDa matrix metalloproteinase-9 | 92 kDa gelatinase | 92 kDa type IV collagenase | GELB | Gelatinase B | MMP-9 | Matrix metalloproteinase 9 (MMP-9) | Matrix metalloproteinase-9 | Matrix metalloproteinase-9 (MMP-9) | Matrix metalloproteinase-9 (MMP9)
Type:Enzyme
Mol. Mass.:78452.28
Organism:Homo sapiens (Human)
Description:P14780
Residue:707
Sequence:
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183734
NameBDBM50183734
Synonyms:4-(2-(hydroxyamino)-2-oxoethyl)-N,N-dimethyl-4-(4-((2-methylquinolin-4-yl)methoxy)benzamido)piperidine-1-carboxamide | CHEMBL207415
TypeSmall organic molecule
Emp. Form.C28H33N5O5
Mol. Mass.519.5921
SMILESCN(C)C(=O)N1CCC(CC(=O)NO)(CC1)NC(=O)c1ccc(OCc2cc(C)nc3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a