Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
LigandBDBM50185586
Substrate/Competitorn/a
Meas. Tech.ChEMBL_371821
IC50 20±n/a nM
Citation Watkins, WJChen, JMCho, AChong, LCollins, NFardis, MHuang, WHung, MKirschberg, TLee, WALiu, XThomas, WXu, JZeynalzadegan, AZhang, J Phosphonic acid-containing analogues of mycophenolic acid as inhibitors of IMPDH. Bioorg Med Chem Lett16:3479-83 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
Name:Inosine-5'-monophosphate dehydrogenase (IMPDH)
Synonyms:IMP dehydrogenase 2 | IMPD 2 | IMPDH-II | Inosine 5'-monophosphate dehydrogenase II (IMPDH II) | Inosine-5 -monophosphate dehydrogenase 2 | Inosine-5''''-monophosphate dehydrogenase 2
Type:Enzyme
Mol. Mass.:55806.87
Organism:Homo sapiens (Human)
Description:Recombinant IMPDH2 expressed in E. coli.
Residue:514
Sequence:
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50185586
NameBDBM50185586
Synonyms:(E)-4-(6-ethyl-4-hydroxy-7-methyl-3-oxo-1,3-dihydroisobenzofuran-5-yl)-2-methylbut-2-enylphosphonic acid | CHEMBL428633
TypeSmall organic molecule
Emp. Form.C16H21O6P
Mol. Mass.340.3081
SMILESCCc1c(C)c2COC(=O)c2c(O)c1C=CC(C)CP(O)(O)=O |w:14.15|
Structure
n/a