Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target20S proteasome chymotrypsin-like
LigandBDBM50410901
Substrate/Competitorn/a
Meas. Tech.ChEMBL_353294
Ki 0.65±n/a nM
Citation Rydzewski, RMBurrill, LMendonca, RPalmer, JTRice, MTahilramani, RBass, KELeung, LGjerstad, EJanc, JWPan, L Optimization of subsite binding to the beta5 subunit of the human 20S proteasome using vinyl sulfones and 2-keto-1,3,4-oxadiazoles: syntheses and cellular properties of potent, selective proteasome inhibitors. J Med Chem49:2953-68 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
20S proteasome chymotrypsin-like
Name:Proteasome subunit beta type-1/beta type-5
Synonyms:26S proteosome | Proteasome Macropain subunit MB1
Type:Protein
Mol. Mass.:28480.96
Organism:Homo sapiens (Human)
Description:n/a
Residue:263
Sequence:
MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50410901
NameBDBM50410901
Synonyms:CHEMBL206413
TypeSmall organic molecule
Emp. Form.C33H44N6O7S
Mol. Mass.668.803
SMILESCC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)NCC(C)(C)C)NS(=O)(=O)c1cccc(C)c1)C(=O)c1nnc(o1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a