Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-gated potassium channel subunit Kv1.5
LigandBDBM50194520
Substrate/Competitorn/a
Meas. Tech.ChEMBL_422064
IC50 3379±n/a nM
Citation Nanda, KKNolt, MBCato, MJKane, SAKiss, LSpencer, RHWang, JLynch, JJRegan, CPStump, GLLi, BWhite, RYeh, SBogusky, MJBilodeau, MTDinsmore, CJLindsley, CWHartman, GDWolkenberg, SETrotter, BW Potent antagonists of the Kv1.5 potassium channel: synthesis and evaluation of analogous N,N-diisopropyl-2-(pyridine-3-yl)acetamides. Bioorg Med Chem Lett16:5897-901 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Voltage-gated potassium channel subunit Kv1.5
Name:Voltage-gated potassium channel
Synonyms:HK2 | HPCN1 | Potassium voltage-gated channel subfamily A member 5 | Voltage-gated potassium channel
Type:Enzyme
Mol. Mass.:67222.47
Organism:Homo sapiens (Human)
Description:P22460
Residue:613
Sequence:
MEIALVPLENGGAMTVRGGDEARAGCGQATGGELQCPPTAGLSDGPKEPAPKGRGAQRDA
DSGVRPLPPLPDPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQ
RVHINISGLRFETQLGTLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQ
SGGRLRRPVNVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIF
EYPESSGSARAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPAPHQPPAPAPGANG
SGVMAPPSGPTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAGFSRNIMNII
DVVAIFPYFITLGTELAEQQPGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGL
QILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADNQGTHFSSIPDAFWWAVVTMTT
VGYGDMRPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEPAVLKEEQG
TQSQGPGLDRGVQRKVSGSRGSFCKAGGTLENADSARRGSCPLEKCNVKAKSNVDLRRSL
YALCLDTSRETDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50194520
NameBDBM50194520
Synonyms:CHEMBL385920 | N1,N1-diisopropyl-3-phenyl-N5-((4-phenylmorpholin-2-yl)methyl)-2-(pyridin-3-yl)pentanediamide
TypeSmall organic molecule
Emp. Form.C33H42N4O3
Mol. Mass.542.7116
SMILESCC(C)N(C(C)C)C(=O)C(C(CC(=O)NCC1CN(CCO1)c1ccccc1)c1ccccc1)c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a