Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibonectin-binding protein C
LigandBDBM50195747
Substrate/Competitorn/a
Meas. Tech.ChEMBL_431881
IC50 110000±n/a nM
Citation Gobec, SPlantan, IMravljak, JSvajger, UWilson, RABesra, GSSoares, SLAppelberg, RKikelj, D Design, synthesis, biochemical evaluation and antimycobacterial action of phosphonate inhibitors of antigen 85C, a crucial enzyme involved in biosynthesis of the mycobacterial cell wall. Eur J Med Chem42:54-63 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibonectin-binding protein C
Name:Fibonectin-binding protein C
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36770.32
Organism:Mycobacterium tuberculosis
Description:ChEMBL_431881
Residue:340
Sequence:
MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVP
SASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQS
SFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILA
AYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQ
IPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNF
PPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50195747
NameBDBM50195747
Synonyms:CHEMBL390336 | ethyl hydrogen4-(phthalimido)butylphosphonate
TypeSmall organic molecule
Emp. Form.C14H18NO5P
Mol. Mass.311.2702
SMILESCCOP(O)(=O)CCCCN1C(=O)c2ccccc2C1=O
Structure
n/a