Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxylesterase
LigandBDBM50022772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_427761
IC50 50±n/a nM
Citation Birkus, GWang, RLiu, XKutty, NMacArthur, HCihlar, TGibbs, CSwaminathan, SLee, WMcDermott, M Cathepsin A is the major hydrolase catalyzing the intracellular hydrolysis of the antiretroviral nucleotide phosphonoamidate prodrugs GS-7340 and GS-9131. Antimicrob Agents Chemother51:543-50 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxylesterase
Name:Carboxylesterase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:62009.98
Organism:Sus scrofa
Description:ChEMBL_427761
Residue:566
Sequence:
MWLLPLVLTSLASSATWAGQPASPPVVDTAQGRVLGKYVSLEGLAQPVAVFLGVPFAKPP
LGSLRFAPPQPAEPWSFVKNTTSYPPMCCQDPVVEQMTSDLFTNGKERLTLEFSEDCLYL
NIYTPADLTKRGRLPVMVWIHGGGLVLGGAPMYDGVVLAAHENVVVVAIQYRLGIWGFFS
TGDEHSRGNWGHLDQVAALHWVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLAKNL
FHRAISESGVALTVALVRKDMKAAAKQIAVLAGCKTTTSAVFVHCLRQKSEDELLDLTLK
MKFLTLDFHGDQRESHPFLPTVVDGVLLPKMPEEILAEKDFNTVPYIVGINKQEFGWLLP
TMMGFPLSEGKLDQKTATSLLWKSYPIANIPEELTPVATDKYLGGTDDPVKKKDLFLDLM
GDVVFGVPSVTVARQHRDAGAPTYMYEFQYRPSFSSDKKPKTVIGDHGDEIFSVFGFPLL
KGDAPEEEVSLSKTVMKFWANFARSGNPNGEGLPHWPMYDQEEGYLQIGVNTQAAKRLKG
EEVAFWNDLLSKEAAKKPPKIKHAEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022772
NameBDBM50022772
Synonyms:CHEMBL1025 | Diisopropoxyphosphoryl fluoride | Diisopropyl fluorophosphonate | Diisopropyl phosphofluoridate | Diisopropyl phosphorofluoridate | Diisopropylfluorophosphate | Diisopropylfluorophosphoric acid ester | Diisopropylphosphorofluoridate | Fluorodiisopropyl phosphate | ISOFLUROPHATE | Isofluorphate | Isoflurophosphate | Isopropyl fluophosphate | Isopropyl phosphorofluoridate | Neoglaucit | O,O'-Diisopropyl phosphoryl fluoride | bis(propan-2-yl) fluorophosphate | diisopropyl fluorophosphate
TypeSmall organic molecule
Emp. Form.C6H14FO3P
Mol. Mass.184.1457
SMILESCC(C)OP(F)(=O)OC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a