Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50165019
Substrate/Competitorn/a
Meas. Tech.ChEMBL_441416
Ki 1±n/a nM
Citation Sonda, SKatayama, KFujio, MSakashita, HInaba, KAsano, KAkira, T 1,5-Benzodioxepin derivatives as a novel class of muscarinic M3 receptor antagonists. Bioorg Med Chem Lett17:925-31 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic acetylcholine receptor M1 and M3
Synonyms:CHRM1 | Cholinergic receptor, muscarinic 1 | Cholinergic, muscarinic M1
Type:Protein
Mol. Mass.:51442.54
Organism:Homo sapiens (Human)
Description:P11229
Residue:460
Sequence:
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50165019
NameBDBM50165019
Synonyms:4-(Diethylamino)-2-butynyl alpha-phenylcyclohexaneglycolic acid ester | 4-(diethylamino)but-2-yn-1-yl cyclohexyl(hydroxy)phenylacetate | 4-Diethylamino-2-butinyl alpha-cyclohexylmandelat | 4-Diethylamino-2-butynyl alpha-phenylcyclohexaneglycolate | Benzeneacetic acid, alpha-cyclohexyl-alpha-hydroxy-, 4-(diethylamino)-2-butynyl ester | CHEMBL1231 | Cyclohexaneglycolic acid, alpha-phenyl-, 4-(diethylamino)-2-butynyl ester | OXYBUTYNIN CHLORIDE
TypeSmall organic molecule
Emp. Form.C22H31NO3
Mol. Mass.357.4864
SMILESCCN(CC)CC#CCOC(=O)C(O)(C1CCCCC1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a