Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2
LigandBDBM50202775
Substrate/Competitorn/a
Meas. Tech.ChEMBL_454055
Ki 0.1±n/a nM
Citation Silverman, LSCaldwell, JPGreenlee, WJKiselgof, EMatasi, JJTulshian, DBArik, LFoster, CBertorelli, RMonopoli, AOngini, E 3H-[1,2,4]-Triazolo[5,1-i]purin-5-amine derivatives as adenosine A2A antagonists. Bioorg Med Chem Lett17:1659-62 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2
Name:Adenosine receptors; A1 & A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50202775
NameBDBM50202775
Synonyms:8-(furan-2-yl)-3-(2-(4-(4-methoxyphenyl)piperazin-1-yl)ethyl)-3H-[1,2,4]triazolo[1,5-g]purin-5-amine | CHEMBL245848
TypeSmall organic molecule
Emp. Form.C23H25N9O2
Mol. Mass.459.5037
SMILESCOc1ccc(cc1)N1CCN(CCn2cnc3c2nc(N)n2nc(nc32)-c2ccco2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a