Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetQuinone oxidoreductase
LigandBDBM50204912
Substrate/Competitorn/a
Meas. Tech.ChEMBL_428131
IC50>50000±n/a nM
Citation Krick, AKehraus, SGerhäuser, CKlimo, KNieger, MMaier, AFiebig, HHAtodiresei, IRaabe, GFleischhauer, JKönig, GM Potential cancer chemopreventive in vitro activities of monomeric xanthone derivatives from the marine algicolous fungus Monodictys putredinis. J Nat Prod70:353-60 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Quinone oxidoreductase
Name:Quinone oxidoreductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35275.21
Organism:Mus musculus
Description:ChEMBL_428131
Residue:331
Sequence:
MATGQKLMRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYS
RKPALPYTPGSDVAGIIESVGDKVSAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPET
LNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTA
GSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLS
HGGRVVVVGCRGPIEINPRDTMAKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKGWVKPV
IGSEYPLEKAAQAHEDIIHGSGKTGKMILLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50204912
NameBDBM50204912
Synonyms:(1S,3S,4S,4aS,9aS)-1,4,8-trihydroxy-6-methoxy-3,4a-dimethyl-1,2,3,4,4a,9a-hexahydro-9H-xanthen-9-one | CHEMBL376473
TypeSmall organic molecule
Emp. Form.C16H20O6
Mol. Mass.308.3264
SMILESCOc1cc(O)c2C(=O)[C@H]3[C@@H](O)C[C@H](C)[C@H](O)[C@@]3(C)Oc2c1
Structure
n/a