Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChymase
LigandBDBM50208224
Substrate/Competitorn/a
Meas. Tech.ChEMBL_429291
Ki 2.3±n/a nM
Citation Greco, MNHawkins, MJPowell, ETAlmond, HRde Garavilla, LHall, JMinor, LKWang, YCorcoran, TWDi Cera, ECantwell, AMSavvides, SNDamiano, BPMaryanoff, BE Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase. J Med Chem50:1727-30 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chymase
Name:Chymase
Synonyms:Alpha-chymase | Chymase precursor | Mast cell protease I
Type:Enzyme
Mol. Mass.:27340.12
Organism:Homo sapiens (Human)
Description:n/a
Residue:247
Sequence:
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208224
NameBDBM50208224
Synonyms:2-(3-((1-(2-naphthoyl)piperidin-4-yl)(methyl)carbamoyl)naphthalen-2-yl)-1-(naphthalen-1-yl)-2-oxoethylphosphonic acid | CHEMBL374027
TypeSmall organic molecule
Emp. Form.C40H35N2O6P
Mol. Mass.670.6895
SMILESCN(C1CCN(CC1)C(=O)c1ccc2ccccc2c1)C(=O)c1cc2ccccc2cc1C(=O)C(c1cccc2ccccc12)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a