Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 10
LigandBDBM50211434
Substrate/Competitorn/a
Meas. Tech.ChEMBL_455592
IC50 82±n/a nM
Citation Alam, MBeevers, RECeska, TDavenport, RJDickson, KMFortunato, MGowers, LHaughan, AFJames, LAJones, MWKinsella, NLowe, CMeissner, JWNicolas, ALPerry, BGPhillips, DJPitt, WRPlatt, ARatcliffe, AJSharpe, ATait, LJ Synthesis and SAR of aminopyrimidines as novel c-Jun N-terminal kinase (JNK) inhibitors. Bioorg Med Chem Lett17:3463-7 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 10
Name:Mitogen-activated protein kinase 10/Receptor-interacting serine/threonine-protein kinase 1
Synonyms:JNK2/JNK3 | MAP kinase p49 3F12 | Mitogen-Activated Protein Kinase 10 (JNK3) | Mitogen-activated protein kinase 10 | Mitogen-activated protein kinase 10 (Stress-activated protein kinase JNK3) (c-Jun N-terminal kinase 3) (MAP kinase p49 3F12). | Stress-activated protein kinase JNK3 | c-Jun N-terminal kinase 3 (JNK3)
Type:Enzyme
Mol. Mass.:52586.89
Organism:Homo sapiens (human)
Description:n/a
Residue:464
Sequence:
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211434
NameBDBM50211434
Synonyms:CHEMBL245533 | ethyl 4-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidine-1-carboxylate
TypeSmall organic molecule
Emp. Form.C20H22ClN5O2
Mol. Mass.399.874
SMILESCCOC(=O)N1CCC(CC1)Nc1ncc(Cl)c(n1)-c1c[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a