Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetc-Jun N-terminal kinase, JNK
LigandBDBM50211427
Substrate/Competitorn/a
Meas. Tech.ChEMBL_455590
IC50 59±n/a nM
Citation Alam, MBeevers, RECeska, TDavenport, RJDickson, KMFortunato, MGowers, LHaughan, AFJames, LAJones, MWKinsella, NLowe, CMeissner, JWNicolas, ALPerry, BGPhillips, DJPitt, WRPlatt, ARatcliffe, AJSharpe, ATait, LJ Synthesis and SAR of aminopyrimidines as novel c-Jun N-terminal kinase (JNK) inhibitors. Bioorg Med Chem Lett17:3463-7 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
c-Jun N-terminal kinase, JNK
Name:c-Jun N-terminal kinase, JNK
Synonyms:JNK-46 | JNK1 | JNK1-alpha-1 | Mitogen-Activated Protein Kinase 8 (JNK1) | Stress-activated protein kinase JNK1 | c-Jun N-terminal kinase 1 | c-Jun N-terminal kinase 1 (JNK1) | c-Jun N-terminal kinase 1(JNK1) | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48297.57
Organism:Homo sapiens (human)
Description:JNK-1 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:427
Sequence:
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211427
NameBDBM50211427
Synonyms:4-(4-(H-imidazo[1,2-a]pyridin-3-yl)pyrimidin-2-ylamino)-N-ethylpiperidine-1-carboxamide | CHEMBL246543
TypeSmall organic molecule
Emp. Form.C19H23N7O
Mol. Mass.365.4322
SMILESCCNC(=O)N1CCC(CC1)Nc1nccc(n1)-c1cnc2ccccn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a