Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50248926
Substrate/Competitorn/a
Meas. Tech.ChEMBL_541388
Ki 0.1±n/a nM
Citation Zampieri, DGrazia Mamolo, MLaurini, EZanette, CFlorio, CCollina, SRossi, DAzzolina, OVio, L Substituted benzo[d]oxazol-2(3H)-one derivatives with preference for the sigma1 binding site. Eur J Med Chem44:124-30 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Opioid receptor | Sigma | Sigma opioid receptor | Sigma-1
Type:Enzyme Catalytic Domain
Mol. Mass.:25266.54
Organism:RAT
Description:Q9R0C9
Residue:223
Sequence:
MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50248926
NameBDBM50248926
Synonyms:3-((1-(4-chlorobenzyl)piperidin-4-yl)methyl)benzo[d]oxazol-2(3H)-one | 3-[[1-(4-Chlorobenzyl)piperidin-4-yl]methyl]benzo[d]oxazol-2(3H)-one | CHEMBL473783
TypeSmall organic molecule
Emp. Form.C20H21ClN2O2
Mol. Mass.356.846
SMILESClc1ccc(CN2CCC(Cn3c4ccccc4oc3=O)CC2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a