Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine kinase
LigandBDBM14487
Substrate/Competitorn/a
Meas. Tech.ChEMBL_491790
Ki 8900±n/a nM
Citation Kim, YASharon, AChu, CKRais, RHAl Safarjalani, ONNaguib, FNel Kouni, MH Structure-activity relationships of 7-deaza-6-benzylthioinosine analogues as ligands of Toxoplasma gondii adenosine kinase. J Med Chem51:3934-45 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine kinase
Name:Adenosine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:38353.04
Organism:Toxoplasma gondii
Description:ChEMBL_629062
Residue:363
Sequence:
MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQ
FNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAP
GQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALE
VAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAE
KTALSTANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEV
GVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTS
LPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14487
NameBDBM14487
Synonyms:(2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol | Adenine-beta-D-arabinofuranoside | Adenosine | CHEMBL477 | N6-Methylado | [U-14C]adenosine | cid_191 | cid_60961
TypeNucleoside or nucleotide
Emp. Form.C10H13N5O4
Mol. Mass.267.2413
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a