Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine kinase
LigandBDBM50252116
Substrate/Competitorn/a
Meas. Tech.ChEMBL_491790
Ki 7200±n/a nM
Citation Kim, YASharon, AChu, CKRais, RHAl Safarjalani, ONNaguib, FNel Kouni, MH Structure-activity relationships of 7-deaza-6-benzylthioinosine analogues as ligands of Toxoplasma gondii adenosine kinase. J Med Chem51:3934-45 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine kinase
Name:Adenosine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:38353.04
Organism:Toxoplasma gondii
Description:ChEMBL_629062
Residue:363
Sequence:
MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQ
FNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAP
GQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALE
VAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAE
KTALSTANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEV
GVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTS
LPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50252116
NameBDBM50252116
Synonyms:4-[(2-Chloro-6-fluorobenzyl)thio]-7-(beta-D-ribofuranosyl)-7Hpyrrolo[2,3-d]pyrimidine | CHEMBL481307
TypeSmall organic molecule
Emp. Form.C18H17ClFN3O4S
Mol. Mass.425.862
SMILESOC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1ccc2c(SCc3c(F)cccc3Cl)ncnc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a