Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic receptor beta
LigandBDBM50267196
Substrate/Competitorn/a
Meas. Tech.ChEMBL_564904
Ki 3±n/a nM
Citation Groszek, GBednarski, MDybala, MFilipek, B Synthesis and adrenolytic activity of 1-(1H-indol-4-yloxy)-3-{[2-(2-methoxyphenoxy)ethyl]amino}propan-2-ol and its enantiomers. Part 1. Eur J Med Chem44:809-17 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adrenergic receptor beta
Name:Adrenergic receptor beta
Synonyms:ADRB1R, B1AR | Beta-1 adrenergic receptor | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1 | adrenergic Beta1,2
Type:Protein
Mol. Mass.:50486.84
Organism:Rattus norvegicus (Rat)
Description:P18090
Residue:466
Sequence:
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVLASPPASLLPPASEGSAPLSQQWTAG
MGLLLALIVLLIVVGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITLPFRYQSLLTRARARALVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLTGPPRPPSPAPSPSPGPPRPADSLANGRSSKRRP
SRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSA
FNPIIYCRSPDFRKAFQRLLCCARRAACRRRAAHGDRPRASGCLARAGPPPSPGAPSDDD
DDDAGATPPARLLEPWAGCNGGTTTVDSDSSLDEPGRQGFSSESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50267196
NameBDBM50267196
Synonyms:(+/-)1-(1H-indol-4-yloxy)-3-(2-(2-methoxyphenoxy)ethylamino)propan-2-ol | (2RS)-1-(1H-Indol-4-yloxy)-3-{[2-(2-methoxyphenoxy)ethyl]amino}propan-2-ol | CHEMBL477465
TypeSmall organic molecule
Emp. Form.C20H24N2O4
Mol. Mass.356.4156
SMILESCOc1ccccc1OCCNCC(O)COc1cccc2[nH]ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a