Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a and A3
LigandBDBM50252755
Substrate/Competitorn/a
Meas. Tech.ChEMBL_539465
Ki 17±n/a nM
Citation Jeong, LSPal, SChoe, SAChoi, WJJacobson, KAGao, ZGKlutz, AMHou, XKim, HOLee, HWLee, SKTosh, DKMoon, HR Structure-activity relationships of truncated D- and l-4'-thioadenosine derivatives as species-independent A3 adenosine receptor antagonists. J Med Chem51:6609-13 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a and A3
Name:Adenosine receptor A2a and A3
Synonyms:Adenosine A3 receptor
Type:PROTEIN
Mol. Mass.:36643.73
Organism:Rattus norvegicus
Description:ChEMBL_479910
Residue:320
Sequence:
MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD
IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY
RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV
FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL
FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR
ACRLCQTSDSLDSNLEQTTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50252755
NameBDBM50252755
Synonyms:(2R,3R,4S)-2-(6-(3-Chlorobenzylamino)-9H-purin-9-yl)-tetrahydrothiophene-3,4-diol | CHEMBL494086
TypeSmall organic molecule
Emp. Form.C16H16ClN5O2S
Mol. Mass.377.849
SMILESO[C@@H]1CS[C@H]([C@@H]1O)n1cnc2c(NCc3cccc(Cl)c3)ncnc12 |r|
Structure
n/a