Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 4 (CCR4)
LigandBDBM50265742
Substrate/Competitorn/a
Meas. Tech.ChEMBL_558791
IC50 100±n/a nM
Citation Yokoyama, KIshikawa, NIgarashi, SKawano, NMasuda, NHamaguchi, WYamasaki, SKoganemaru, YHattori, KMiyazaki, TOgino, SMatsumoto, YTakeuchi, MOhta, M Potent and orally bioavailable CCR4 antagonists: Synthesis and structure-activity relationship study of 2-aminoquinazolines. Bioorg Med Chem17:64-73 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 4 (CCR4)
Name:C-C chemokine receptor type 4
Synonyms:C-C CKR-4 | C-C chemokine receptor type 4 | CC-CKR-4 | CCR-4 | CCR4 | CD_antigen=CD194 | K5-5
Type:Enzyme
Mol. Mass.:41406.41
Organism:Homo sapiens (Human)
Description:P51679
Residue:360
Sequence:
MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVV
VLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVG
FYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYT
ERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKA
VKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFERYLDYAIQATETLAFVHCCLN
PIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQSTMDHDLHDAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50265742
NameBDBM50265742
Synonyms:CHEMBL521737 | {1'-[4-(Cycloheptylamino)-6,7-dimethoxyquinazolin-2-yl]-1,4'-bipiperidin-3-yl}methanol
TypeSmall organic molecule
Emp. Form.C28H43N5O3
Mol. Mass.497.6727
SMILESCOc1cc2nc(nc(NC3CCCCCC3)c2cc1OC)N1CCC(CC1)N1CCCC(CO)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a