Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen Phosphorylase (PYGL)
LigandBDBM50243599
Substrate/Competitorn/a
Meas. Tech.ChEMBL_515050
IC50 21±n/a nM
Citation Sparks, SMBanker, PBickett, DMCarter, HLClancy, DCDickerson, SHDwornik, KAGarrido, DMGolden, PLNolte, RTPeat, AJSheckler, LRTavares, FXThomson, SAWang, LWeiel, JE Anthranilimide-based glycogen phosphorylase inhibitors for the treatment of type 2 diabetes: 1. Identification of 1-amino-1-cycloalkyl carboxylic acid headgroups. Bioorg Med Chem Lett19:976-80 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycogen Phosphorylase (PYGL)
Name:Liver glycogen phosphorylase
Synonyms:Glycogen Phosphorylase, liver form
Type:Homodimer
Mol. Mass.:97153.98
Organism:Homo sapiens (Human)
Description:Dimers associate into a tetramer to form the enzymatically active phosphorylase A.
Residue:847
Sequence:
MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDI
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQ
ENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFV
PRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50243599
NameBDBM50243599
Synonyms:(S)-2-cyclohexyl-2-(2-(3-(2,6-dichlorophenyl)ureido)-2-naphthamido)acetic acid | (S)-2-cyclohexyl-2-(3-(3-(2,6-dichlorophenyl)ureido)-2-naphthamido)acetic acid | CHEMBL516945
TypeSmall organic molecule
Emp. Form.C26H25Cl2N3O4
Mol. Mass.514.4
SMILESOC(=O)[C@@H](NC(=O)c1cc2ccccc2cc1NC(=O)Nc1c(Cl)cccc1Cl)C1CCCCC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a