Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSterol O-acyltransferase 1
LigandBDBM50276484
Substrate/Competitorn/a
Meas. Tech.ChEMBL_540911
IC50 47±n/a nM
Citation Asano, SBan, HKino, KIoriya, KMuraoka, M Novel 1,4-diarylpiperidine-4-methylureas as anti-hyperlipidemic agents: dual effectors on acyl-CoA:cholesterol O-acyltransferase and low-density lipoprotein receptor expression. Bioorg Med Chem Lett19:1062-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sterol O-acyltransferase 1
Name:Sterol O-acyltransferase 1
Synonyms:Acetyl-CoA acetyltransferase, mitochondrial | Acyl coenzyme A:cholesterol acyltransferase 1 | Acyl-CoA: cholesterol acyltransferase (ACAT) | Acyl-coenzyme A:cholesterol acyltransferase 1 (ACAT1) | Cholesterol acyltransferase 1 | SOAT1
Type:Multi-pass membrane protein may form homo- or heterodimers.
Mol. Mass.:64751.94
Organism:Homo sapiens (Human)
Description:P35610
Residue:550
Sequence:
MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEE
LKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGK
IFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGK
FPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPT
YVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF
LFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSAR
VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW
NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFM
FFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVR
PRSWTCRYVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50276484
NameBDBM50276484
Synonyms:1-(2,6-diisopropylphenyl)-3-((1-(2-methoxyphenyl)-4-(3-methoxyphenyl)piperidin-4-yl)methyl)urea | CHEMBL510453
TypeSmall organic molecule
Emp. Form.C33H43N3O3
Mol. Mass.529.7128
SMILESCOc1cccc(c1)C1(CNC(=O)Nc2c(cccc2C(C)C)C(C)C)CCN(CC1)c1ccccc1OC
Structure
n/a