Target
Caspase-1
Ligand
BDBM50284734
Substrate
n/a
Meas. Tech.
ChEBML_90989
KON
4100 M-1s-1
Citation
 Mjalli, AMZhao, JJChapman, KTThornberry, NAPeterson, EPMacCoss, MHagmann, WK Inhibition of interleukin-1β converting enzyme by N-acyl-aspartyl aryloxymethyl ketones Bioorg Med Chem Lett 5:1409-1414 (1995)    Article
Target
Name:
Caspase-1
Synonyms:
Caspase | Caspase 1 | ICE | Interleukin-1 beta convertase | Interleukin-1 beta-converting enzyme
Type:
Enzyme
Mol. Mass.:
45154.13
Organism:
Homo sapiens (Human)
Description:
P29466
Residue:
404
Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
  
Inhibitor
Name:
BDBM50284734
Synonyms:
3-Allyloxycarbonylamino-4-oxo-5-(3-phenylcarbamoyl-naphthalen-2-yloxy)-pentanoic acid | CHEMBL281745
Type:
Small organic molecule
Emp. Form.:
C26H24N2O7
Mol. Mass.:
476.478
SMILES:
OC(=O)CC(NC(=O)OCC=C)C(=O)COc1cc2ccccc2cc1C(=O)Nc1ccccc1
Structure:
Search PDB for entries with ligand similarity: