Target
Neutrophil elastase
Ligand
BDBM50286678
Substrate
n/a
Meas. Tech.
ChEBML_86700
KON
80 M-1s-1
Citation
 Alpegiani, MBissolino, PCorigli, RRizzo, VPerrone, E Tricyclic cephems as inhibitors of human leukocyte elastase. thieno[3,4-c]cepham sulfones and pyrrolo[3,4-c]cepham sulfones Bioorg Med Chem Lett 5:691-694 (1995)    Article
Target
Name:
Neutrophil elastase
Synonyms:
Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:
Enzyme
Mol. Mass.:
28532.38
Organism:
Homo sapiens (Human)
Description:
P08246
Residue:
267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
  
Inhibitor
Name:
BDBM50286678
Synonyms:
(2S,2aR)-7-tert-Butyl-2-methoxy-3,3-dioxo-2,2a,3,4-tetrahydro-3lambda*6*,6-dithia-7b-aza-cyclobuta[e]inden-1-one | CHEMBL159512
Type:
Small organic molecule
Emp. Form.:
C13H17NO4S2
Mol. Mass.:
315.408
SMILES:
CO[C@@H]1[C@@H]2N(C1=O)c1c(CS2(=O)=O)csc1C(C)(C)C
Structure:
Search PDB for entries with ligand similarity: