Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a and A3
LigandBDBM50300282
Substrate/Competitorn/a
Meas. Tech.ChEMBL_590642
Ki 8.68±n/a nM
Citation Tosh, DKChinn, MIvanov, AAKlutz, AMGao, ZGJacobson, KA Functionalized congeners of A3 adenosine receptor-selective nucleosides containing a bicyclo[3.1.0]hexane ring system. J Med Chem52:7580-92 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a and A3
Name:Adenosine receptor A2a and A3
Synonyms:Adenosine A3 receptor
Type:PROTEIN
Mol. Mass.:36643.73
Organism:Rattus norvegicus
Description:ChEMBL_479910
Residue:320
Sequence:
MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD
IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY
RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV
FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL
FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR
ACRLCQTSDSLDSNLEQTTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50300282
NameBDBM50300282
Synonyms:(1'S, 2'R, 3'S, 4'S, 5'S)-4'-[6-(3-Chlorobenzylamino)-2-(4-(delta-aminobutylaminocarbonyl)-1-butynyl)-9-yl]-2',3'-dihydroxybicyclo[3.1.0]hexane-1'-carboxylic acid N-methylamide | CHEMBL583745
TypeSmall organic molecule
Emp. Form.C29H35ClN8O4
Mol. Mass.595.092
SMILESCNC(=O)[C@]12C[C@@H]1[C@H]([C@H](O)[C@@H]2O)n1cnc2c(NCc3cccc(Cl)c3)nc(nc12)C#CCCC(=O)NCCCCN |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a