Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUTS2R
LigandBDBM50302231
Substrate/Competitorn/a
Meas. Tech.ChEMBL_596665
IC50 150±n/a nM
Citation Lawson, ECLuci, DKGhosh, SKinney, WAReynolds, CHQi, JSmith, CEWang, YMinor, LKHaertlein, BJParry, TJDamiano, BPMaryanoff, BE Nonpeptide urotensin-II receptor antagonists: a new ligand class based on piperazino-phthalimide and piperazino-isoindolinone subunits. J Med Chem52:7432-45 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
UTS2R
Name:UTS2R
Synonyms:G-protein coupled receptor 14 | G-protein coupled sensory epithelial neuropeptide-like receptor | SENR | UR-II-R | Urotensin-II
Type:Enzyme Catalytic Domain
Mol. Mass.:42725.34
Organism:RAT
Description:Urotensin-II UTS2R RAT::P49684
Residue:386
Sequence:
MALSLESTTSFHMLTVSGSTVTELPGDSNVSLNSSWSGPTDPSSLKDLVATGVIGAVLSA
MGVVGMVGNVYTLVVMCRFLRASASMYVYVVNLALADLLYLLSIPFIIATYVTKDWHFGD
VGCRVLFSLDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYRKLLVLGTWLLALLL
TLPMMLAIQLVRRGSKSLCLPAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYVRLARAYWL
SQQASFKQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYHEAMPLTPETARIVNY
LTTCLTYGNSCINPFLYTLLTKNYREYLRGRQRSLGSSCHSPGSPGSFLPSRVHLQQDSG
RSLSSSSQQATETLMLSPVPRNGALL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50302231
NameBDBM50302231
Synonyms:2-((R)-1-(3,4-dimethoxyphenyl)ethyl)-4-(4-((R)-1-phenylethyl)piperazin-1-yl)isoindoline-1,3-dione | CHEMBL571683
TypeSmall organic molecule
Emp. Form.C30H33N3O4
Mol. Mass.499.6007
SMILESCOc1ccc(cc1OC)[C@@H](C)N1C(=O)c2cccc(N3CCN(CC3)[C@H](C)c3ccccc3)c2C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a