Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrotensin II receptor
LigandBDBM50302238
Substrate/Competitorn/a
Meas. Tech.ChEMBL_596666
Ki 270±n/a nM
Citation Lawson, ECLuci, DKGhosh, SKinney, WAReynolds, CHQi, JSmith, CEWang, YMinor, LKHaertlein, BJParry, TJDamiano, BPMaryanoff, BE Nonpeptide urotensin-II receptor antagonists: a new ligand class based on piperazino-phthalimide and piperazino-isoindolinone subunits. J Med Chem52:7432-45 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Urotensin II receptor
Name:Urotensin II receptor
Synonyms:G-protein coupled receptor 14 | UR-II-R | Urotensin-II
Type:Enzyme Catalytic Domain
Mol. Mass.:42159.71
Organism:Homo sapiens (Human)
Description:Urotensin-II UTS2R HUMAN::Q9UKP6
Residue:389
Sequence:
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA
MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD
VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL
TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR
SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT
TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS
SCSPQPTDSLVLAPAAPARPAPEGPRAPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50302238
NameBDBM50302238
Synonyms:CHEMBL566565 | N-(3-(3,4-dimethoxyphenyl)-3-(1,3-dioxo-4-(4-((R)-1-phenylethyl)piperazin-1-yl)isoindolin-2-yl)propyl)thiophene-2-sulfonamide
TypeSmall organic molecule
Emp. Form.C35H38N4O6S2
Mol. Mass.674.829
SMILESCOc1ccc(cc1OC)C(CCNS(=O)(=O)c1cccs1)N1C(=O)c2cccc(N3CCN(CC3)[C@H](C)c3ccccc3)c2C1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a