Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine oxidase
LigandBDBM15613
Substrate/Competitorn/a
Meas. Tech.ChEMBL_601025
IC50 5700±n/a nM
Citation Gökhan-Kelekçi, NSimsek, OOErcan, AYelekçi, KSahin, ZSIsik, SUçar, GBilgin, AA Synthesis and molecular modeling of some novel hexahydroindazole derivatives as potent monoamine oxidase inhibitors. Bioorg Med Chem17:6761-72 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine oxidase
Name:Monoamine oxidase
Synonyms:Amine oxidase (flavin-containing) A | Amine oxidase [flavin-containing] A | Monoamine Oxidase Type A (MAO-A) | Monoamine oxidase A (MAO-A) | Monoamine oxidase A (rMAO-A) | Monoamine oxidase type A (MAOA)
Type:Enzyme
Mol. Mass.:59515.21
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:526
Sequence:
MTDLEKPNLAGHMFDVGLIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHV
KWVDVGGAYVGPTQNRILRLSKELGIETYKVNVNERLVQYVKGKTYPFRGAFPPVWNPLA
YLDYNNLWRTMDEMGKEIPVDAPWQARHAQEWDKMTMKDLIDKICWTKTAREFAYLFVNI
NVTSEPHEVSALWFLWYVRQCGGTARIFSVTNGGQERKFVGGSGQVSEQIMGLLGDKVKL
SSPVTYIDQTDDNIIVETLNHEHYECKYVISAIPPILTAKIHFKPELPPERNQLIQRLPM
GAVIKCMVYYKEAFWKKKDYCGCMIIEDEEAPIAITLDDTKPDGSLPAIMGFILARKADR
QAKLHKDIRKRKICELYAKVLGSQEALYPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKVAKKDIWVEEPESKD
VPAIEITHTFLERNLPSVPGLLKITGVSTSVALLCFVLYKIKKLPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15613
NameBDBM15613
Synonyms:4-chloro-N-(2-morpholin-4-ylethyl)benzamide | 4-chloro-N-[2-(morpholin-4-yl)ethyl]benzamide | Aurorix | CHEMBL86304 | MCL | Moclobemide
TypeSmall organic molecule
Emp. Form.C13H17ClN2O2
Mol. Mass.268.739
SMILESClc1ccc(cc1)C(=O)NCCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a