Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase
LigandBDBM50022772
Substrate/Competitorn/a
Meas. Tech.ChEMBL_613427
Ki 6000±n/a nM
Citation Dutta, SMalla, RKBandyopadhyay, SSpilling, CDDupureur, CM Synthesis and kinetic analysis of some phosphonate analogs of cyclophostin as inhibitors of human acetylcholinesterase. Bioorg Med Chem18:2265-74 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylcholinesterase
Name:Cholinesterases; ACHE & BCHE
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase (human AChE)
Type:Enzyme
Mol. Mass.:67792.70
Organism:Homo sapiens (Human)
Description:n/a
Residue:614
Sequence:
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRGIRLKTPGGPV
SAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSM
NYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPE
DPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGY
EIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQ
YVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022772
NameBDBM50022772
Synonyms:CHEMBL1025 | Diisopropoxyphosphoryl fluoride | Diisopropyl fluorophosphonate | Diisopropyl phosphofluoridate | Diisopropyl phosphorofluoridate | Diisopropylfluorophosphate | Diisopropylfluorophosphoric acid ester | Diisopropylphosphorofluoridate | Fluorodiisopropyl phosphate | ISOFLUROPHATE | Isofluorphate | Isoflurophosphate | Isopropyl fluophosphate | Isopropyl phosphorofluoridate | Neoglaucit | O,O'-Diisopropyl phosphoryl fluoride | bis(propan-2-yl) fluorophosphate | diisopropyl fluorophosphate
TypeSmall organic molecule
Emp. Form.C6H14FO3P
Mol. Mass.184.1457
SMILESCC(C)OP(F)(=O)OC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a