Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-Phosphate Receptor 4
LigandBDBM23165
Substrate/Competitorn/a
Meas. Tech.ChEMBL_624585
EC50 22.16±n/a nM
Citation Ma, BGuckian, KMLin, EYLee, WCScott, DKumaravel, GMacdonald, TLLynch, KRBlack, CChollate, SHahm, KHetu, GJin, PLuo, YRohde, ERossomando, AScannevin, RWang, JYang, C Stereochemistry-activity relationship of orally active tetralin S1P agonist prodrugs. Bioorg Med Chem Lett20:2264-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-Phosphate Receptor 4
Name:Sphingosine 1-phosphate receptor
Synonyms:EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41647.39
Organism:Homo sapiens (Human)
Description:n/a
Residue:384
Sequence:
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23165
NameBDBM23165
Synonyms:CHEMBL366208 | FTY720-phosphate, (S)-2 | [(2S)-2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy]phosphonic acid
TypeSmall organic molecule
Emp. Form.C19H34NO5P
Mol. Mass.387.4507
SMILESCCCCCCCCc1ccc(CC[C@](N)(CO)COP(O)(O)=O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a