Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM50324886
Substrate/Competitorn/a
Meas. Tech.ChEMBL_651487
IC50 118±n/a nM
Citation Park, CMKim, SYPark, WKChoi, JHSeong, CM Synthesis and SAR of (piperazin-1-yl-phenyl)-arylsulfonamides: a novel series of atypical antipsychotic agents. Bioorg Med Chem Lett20:5221-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2A
Name:Dopamine D2 receptor and serotonin 2a receptor
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2 | HTR2A | Serotonin receptor 2A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52607.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:471
Sequence:
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50324886
NameBDBM50324886
Synonyms:CHEMBL1222134 | naphthalene-2-sulfonic acid isopropyl-[3-(4-methyl-piperazin-1-yl)-phenyl]-amide
TypeSmall organic molecule
Emp. Form.C24H29N3O2S
Mol. Mass.423.571
SMILESCC(C)N(c1cccc(c1)N1CCN(C)CC1)S(=O)(=O)c1ccc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a