Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled bile acid receptor 1
LigandBDBM50327520
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664649
IC50 4300±n/a nM
Citation Herbert, MRSiegel, DLStaszewski, LCayanan, CBanerjee, UDhamija, SAnderson, JFan, AWang, LRix, PShiau, AKRao, TSNoble, SAHeyman, RABischoff, EGuha, MKabakibi, APinkerton, AB Synthesis and SAR of 2-aryl-3-aminomethylquinolines as agonists of the bile acid receptor TGR5. Bioorg Med Chem Lett20:5718-21 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled bile acid receptor 1
Name:G-protein coupled bile acid receptor 1
Synonyms:M-BAR | Membrane-type receptor for bile acids
Type:PROTEIN
Mol. Mass.:35665.78
Organism:Mus musculus
Description:ChEMBL_1475560
Residue:329
Sequence:
MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAG
LLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPH
GSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGAT
ALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYV
ATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRV
LRGRAKRDNPGPSTAYHTSSQCSIDLDLN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327520
NameBDBM50327520
Synonyms:CHEMBL1258310 | N-(4-chlorobenzyl)-1-(7-methoxy-2-(thiophen-3-yl)quinolin-3-yl)methanamine
TypeSmall organic molecule
Emp. Form.C22H19ClN2OS
Mol. Mass.394.917
SMILESCOc1ccc2cc(CNCc3ccc(Cl)cc3)c(nc2c1)-c1ccsc1
Structure
n/a