Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM50333510
Substrate/Competitorn/a
Meas. Tech.ChEMBL_699500
Ki 60±n/a nM
Citation Xiao, DPalani, ASofolarides, MHuang, YAslanian, RVaccaro, HHong, LMcKittrick, BWest, REWilliams, SMWu, RLHwa, JSondey, CLachowicz, J Discovery of a series of potent arylthiadiazole H(3) antagonists. Bioorg Med Chem Lett21:861-4 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:G-protein coupled receptor 97 | HH3R | HISTAMINE H3 | HRH3 | Histamine H3 receptor (H3) | Histamine H3L | Histamine receptor (H3 and H4)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48691.47
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH3R receptors.
Residue:445
Sequence:
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS
SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA
GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL
AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR
RAFTKLLCPQKLKIQPHSSLEHCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50333510
NameBDBM50333510
Synonyms:2-(1,4'-bipiperidin-1'-yl)-5-m-tolyl-1,3,4-thiadiazole | CHEMBL1641827
TypeSmall organic molecule
Emp. Form.C19H26N4S
Mol. Mass.342.502
SMILESCc1cccc(c1)-c1nnc(s1)N1CCC(CC1)N1CCCCC1
Structure
n/a