Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDipeptidyl peptidase IX
LigandBDBM50356573
Substrate/Competitorn/a
Meas. Tech.ChEMBL_776113
Ki 1844±n/a nM
Citation Wang, WDevasthale, PWang, AHarrity, TEgan, DMorgan, NCap, MFura, AKlei, HEKish, KWeigelt, CSun, LLevesque, PLi, YXZahler, RKirby, MSHamann, LG 7-Oxopyrrolopyridine-derived DPP4 inhibitors-mitigation of CYP and hERG liabilities via introduction of polar functionalities in the active site. Bioorg Med Chem Lett21:6646-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dipeptidyl peptidase IX
Name:Dipeptidyl peptidase IX
Synonyms:DPP9 | DPRP-2 | Dipeptidyl peptidase 9 (DDP9) | Dipeptidyl peptidase 9 (DPP-9) | Dipeptidyl peptidase 9 (DPP9) | Dipeptidyl peptidase IV-related protein 2 | Dipeptidyl peptidase IX (DDP-IX) | Dipeptidyl peptidase-like protein 9
Type:Enzyme
Mol. Mass.:98260.70
Organism:Homo sapiens (Human)
Description:Q86TI2
Residue:863
Sequence:
MATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQ
KTDESGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHGV
YSREEELLRERKRLGVFGITSYDFHSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPLEI
KTQCSGPRMDPKICPADPAFFSFINNSDLWVANIETGEERRLTFCHQGLSNVLDDPKSAG
VATFVIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEVDESEVEVIHVPSPALEERKT
DSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSSLFPKVEYIARAGWTRD
GKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVW
INVHDIFYPFPQSEGEDELCFLRANECKTGFCHLYKVTAVLKSQGYDWSEPFSPGEDEFK
CPIKEEIALTSGEWEVLARHGSKIWVNEETKLVYFQGTKDTPLEHHLYVVSYEAAGEIVR
LTTPGFSHSCSMSQNFDMFVSHYSSVSTPPCVHVYKLSGPDDDPLHKQPRFWASMMEAAS
CPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIK
YLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFID
LSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHG
YEAGSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERH
SIRCPESGEHYEVTLLHFLQEYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50356573
NameBDBM50356573
Synonyms:CHEMBL1909991
TypeSmall organic molecule
Emp. Form.C22H19Cl2N3O2
Mol. Mass.428.311
SMILESCOc1ccccc1N1Cc2c(nc(C)c(CN)c2-c2ccc(Cl)cc2Cl)C1=O |(-5.92,-13.99,;-5.15,-12.66,;-5.92,-11.33,;-7.46,-11.33,;-8.24,-9.99,;-7.46,-8.66,;-5.92,-8.66,;-5.16,-10,;-3.62,-10,;-2.72,-11.24,;-1.26,-10.77,;-1.25,-9.23,;.07,-8.45,;1.41,-9.22,;2.74,-8.44,;1.41,-10.77,;2.75,-11.54,;4.08,-10.76,;.08,-11.54,;.08,-13.08,;-1.26,-13.84,;-1.26,-15.38,;.08,-16.15,;.08,-17.69,;1.42,-15.38,;1.41,-13.84,;2.74,-13.07,;-2.72,-8.75,;-3.19,-7.29,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a