Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdhesin protein fimH
LigandBDBM50357411
Substrate/Competitorn/a
Meas. Tech.ChEMBL_788106
IC50 296±n/a nM
Citation Schwardt, ORabbani, SHartmann, MAbgottspon, DWittwer, MKleeb, SZalewski, ASmieško, MCutting, BErnst, B Design, synthesis and biological evaluation of mannosyl triazoles as FimH antagonists. Bioorg Med Chem19:6454-73 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adhesin protein fimH
Name:Adhesin protein fimH
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:31474.61
Organism:Escherichia coli (strain K12)
Description:ChEMBL_1298296
Residue:300
Sequence:
MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLS
TQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRT
DKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
GCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQ
GVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50357411
NameBDBM50357411
Synonyms:CHEMBL1917304
TypeSmall organic molecule
Emp. Form.C16H18N3O8
Mol. Mass.380.33
SMILESOC[C@H]1O[C@H](OCc2cn(nn2)-c2cccc(c2)C([O-])=O)[C@@H](O)[C@@H](O)[C@@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a