BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelin-1 receptor
LigandBDBM50366419
Substrate/Competitorn/a
Meas. Tech.ChEBML_63195
IC50 24000±n/a nM
Citation Leonard, DMReily, MDDunbar, JBHolub, KECody, WLHill, KEWelch, KMFlynn, MAReynolds, EEDoherty, AM Structure-activity and biophysical studies of the C-terminal hexapeptide of endothelin Bioorg Med Chem Lett5:967-972 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Endothelin-1 receptor
Name:Endothelin-1 receptor
Synonyms:EDNRA | ET-A | ETA | ETA-R | ETRA | Endothelin receptor type A | hET-AR
Type:Enzyme Catalytic Domain
Mol. Mass.:48736.88
Organism:Homo sapiens (Human)
Description:P25101
Residue:427
Sequence:
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50366419
NameBDBM50366419
Synonyms:CHEMBL2369710
TypeSmall organic molecule
Emp. Form.C43H58N8O9
Mol. Mass.830.9688
SMILESCC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(C)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a