BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhospholipase A2 group IIC
LigandBDBM50289485
Substrate/Competitorn/a
Meas. Tech.ChEBML_199687
IC50 570±n/a nM
Citation Lee, DMarshall, LABolognese, BAdams, JL Tetrazole is an effective Sn-3 phosphate replacement in substrate analog inhibitors of 14 kDa phospholipase A2 Bioorg Med Chem Lett7:1427-1432 (1997)    Article
More Info.:Get all data from this article,  Assay Method
 
Phospholipase A2 group IIC
Name:Phospholipase A2 group IIC
Synonyms:Phosphatidylcholine 2-acylhydrolase-like protein GIIC | Putative inactive group IIC secretory phospholipase A2
Type:PROTEIN
Mol. Mass.:16855.80
Organism:Homo sapiens (Human)
Description:ChEMBL_199685
Residue:149
Sequence:
MKVIAILTLLLFCSPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDTDR
HSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSVH
CFKESLPTYEKNFKQFSSQPRCGRHKPWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50289485
NameBDBM50289485
Synonyms:CHEMBL289247 | N-[1-Octadecyloxymethyl-3-(1H-tetrazol-5-yl)-propyl]-acetamide
TypeSmall organic molecule
Emp. Form.C25H49N5O2
Mol. Mass.451.6889
SMILESCCCCCCCCCCCCCCCCCCOCC(CCc1nnn[nH]1)NC(C)=O
Structure
n/a