Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M2
LigandBDBM50008072
Substrate/Competitorn/a
Meas. Tech.ChEBML_139656
EC50 63000±n/a nM
Citation Sauerberg, PJeppesen, LOlesen, PHSheardown, MJFink-Jensen, ARasmussen, TRimvall, KShannon, HEBymaster, FPDeLapp, NWCalligaro, DOWard, JSWhitesitt, CAThomsen, C Identification of side chains on 1,2,5-thiadiazole-azacycles optimal for muscarinic m1 receptor activation. Bioorg Med Chem Lett8:2897-902 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor M2
Name:Muscarinic acetylcholine receptor M2 and M4
Synonyms:CHRM2 | Cholinergic, muscarinic M2 | RecName: Full=Muscarinic acetylcholine receptor M2
Type:GPCR
Mol. Mass.:51730.61
Organism:Homo sapiens (Human)
Description:P08172
Residue:466
Sequence:
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI
VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50008072
NameBDBM50008072
Synonyms:(+)-pilocarpine | (3S,4R)-3-ethyl-4-[(1-methyl-1H-imidazol-5-yl)methyl]dihydrofuran-2(3H)-one | (3S,4R)-3-ethyldihydro-4-((1-methyl-1H-imidazol-5-yl)methyl)-2(3H)-furanone | (3S-cis)-3-ethyldihydro-4-[(1-methyl-1H-imidazol-5-yl)methyl]-2(3H)-furanone | CHEMBL550 | ISOPTO CARPINE | PILOCARPINE | PILOCARPINE HYDROCHLORIDE
TypeSmall organic molecule
Emp. Form.C11H16N2O2
Mol. Mass.208.2569
SMILESCC[C@H]1[C@@H](Cc2cncn2C)COC1=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a