Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlyceraldehyde-3-phosphate dehydrogenase liver
LigandBDBM50096600
Substrate/Competitorn/a
Meas. Tech.ChEMBL_69912
IC50 12000±n/a nM
Citation Kennedy, KJBressi, JCGelb, MH A disubstituted NAD+ analogue is a nanomolar inhibitor of trypanosomal glyceraldehyde-3-phosphate dehydrogenase. Bioorg Med Chem Lett11:95-8 (2001) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glyceraldehyde-3-phosphate dehydrogenase liver
Name:Glyceraldehyde-3-phosphate dehydrogenase liver
Synonyms:glyceraldehyde-3-phosphate dehydrogenase
Type:PROTEIN
Mol. Mass.:36060.86
Organism:Homo sapiens (Human)
Description:ChEMBL_1511315
Residue:335
Sequence:
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096600
NameBDBM50096600
Synonyms:CHEMBL464924 | N-((2R,3R,4S,5R)-4-Hydroxy-5-hydroxymethyl-2-{6-[(naphthalen-1-ylmethyl)-amino]-purin-9-yl}-tetrahydro-furan-3-yl)-3-methoxy-benzamide | N-((2R,3R,4S,5R)-4-hydroxy-5-(hydroxymethyl)-2-(6-(naphthalen-1-ylmethylamino)-9H-purin-9-yl)tetrahydrofuran-3-yl)-3-methoxybenzamide | N-(4-Hydroxy-5-hydroxymethyl-2-{6-[(naphthalen-1-ylmethyl)-amino]-9H-purin-3-ylmethyl}-tetrahydro-furan-3-yl)-3-methoxy-benzamide
TypeSmall organic molecule
Emp. Form.C29H28N6O5
Mol. Mass.540.5698
SMILESCOc1cccc(c1)C(=O)N[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1n1cnc2c(NCc3cccc4ccccc34)ncnc12 |r|
Structure
n/a