Reaction Details |
 | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50367055 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54608 |
---|
Ki | 0.002300±n/a nM |
---|
Citation | DeGraw, JI; Brown, VH; Tagawa, H; Kisliuk, RL; Gaumont, Y; Sirotnak, FM Synthesis and antitumor activity of 10-alkyl-10-deazaminopterins. A convenient synthesis of 10-deazaminopterin. J Med Chem25:1227-30 (1983) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 21608.82 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPELASKVDMVWIVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50367055 |
---|
Name | BDBM50367055 |
Synonyms: | 4-Aminofolic acid | 4-Aminopteroic acid | AMINOPTERIN | Aminopteroylglutamic acid |
Type | Small organic molecule |
Emp. Form. | C19H20N8O5 |
Mol. Mass. | 440.4127 |
SMILES | Nc1nc(N)c2nc(CNc3ccc(cc3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)cnc2n1 |r| |
Structure |  |
n/a |
---|