Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhizopuspepsin
LigandBDBM50405190
Substrate/Competitorn/a
Meas. Tech.ChEBML_193377
pH7.4±n/a
Ki 21±n/a nM
Commentsextracted
Citation Boger, JPayne, LSPerlow, DSLohr, NSPoe, MBlaine, EHUlm, EHSchorn, TWLaMont, BILin, TY Renin inhibitors. Syntheses of subnanomolar, competitive, transition-state analogue inhibitors containing a novel analogue of statine. J Med Chem28:1779-90 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Rhizopuspepsin
Name:Renin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:44272.67
Organism:Rhizopus chinensis
Description:ChEMBL_193377
Residue:402
Sequence:
MGGRRMPLWALLLLWTSCSFSLPTDTASFGRILLKKMPSVREILEERGVDMTRISAEWGE
FIKKSSFTNVTSPVVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYT
ACEIHNLYDSSESSSYMENGTEFTIHYGSGKVKGFLSQDVVTVGGIIVTQTFGEVTELPL
IPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQRVLKEEVFSVYYSRESHLLGGEVVLG
GSDPQHYQGNFHYVSISKAGSWQITMKGVSVGPATLLCEEGCMAVVDTGTSYISGPTSSL
QLIMQALGVKEKRANNYVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFRNDDLCIL
ALQGLDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50405190
NameBDBM50405190
Synonyms:CHEMBL2028991
TypeSmall organic molecule
Emp. Form.C57H80N12O9
Mol. Mass.1077.3201
SMILESCC(C)C[C@H](NC(=O)CC(O)[C@H](CC1CCCCC1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1cnc[nH]1)NC(=O)CC(C)C)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a