Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDRD2
LigandBDBM50025206
Substrate/Competitorn/a
Meas. Tech.ChEBML_59480
Ki 255±n/a nM
Citation Ladd, DLWeinstock, JWise, MGessner, GWSawyer, JLFlaim, KE Synthesis and dopaminergic binding of 2-aryldopamine analogues: phenethylamines, 3-benzazepines, and 9-(aminomethyl)fluorenes. J Med Chem29:1904-12 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DRD2
Name:Dopamine receptor
Synonyms:DOPAMINE D2 | Dopamine D2 receptor | Dopamine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:50698.79
Organism:BOVINE
Description:DOPAMINE D2 DRD2 BOVINE::P20288
Residue:444
Sequence:
MDPLNLSWYDDDPESRNWSRPFNGSEGKADRPPYNYYAMLLTLLIFVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKTVNPKIAKIFEIQSMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50025206
NameBDBM50025206
Synonyms:(6,7-Dihydroxy-1,2,3,4-tetrahydro-naphthalen-2-yl)-dimethyl-ammonium | TL99
TypeSmall organic molecule
Emp. Form.C12H18NO2
Mol. Mass.208.2763
SMILESC[NH+](C)C1CCc2cc(O)c(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a